A beta sheet from a sucrose specific porin as cartoon

Free Printables Marius Mihasan

A beta sheet from a sucrose specific porin as cartoon

A betasheet from 1A0Spdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 chain ...

— Go to Printables

similar models —

A beta sheet from a sucrose specific porin as cartoon alternatives

A betasheet from a sucrose specific porin as cartoon with the sidechains visible

Marius Mihasan

A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible

A betasheet from a sucrose specific porin as balls and sticks

Marius Mihasan

A beta-sheet from a sucrose specific porin as balls and sticks

A beta sheet from a sucrose specific porin as surface

Marius Mihasan

A beta sheet from a sucrose specific porin as surface

An alpha helix from Hemoglobin as cartoon

Marius Mihasan

An alpha helix from Hemoglobin as cartoon

A betasheet from a sucrose specific porin peptide backbone as balls and sticks

Marius Mihasan

A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks

Spirit Geolink bracket

NZ2000

Spirit Geolink bracket

The Holy Hand Grenade

popejpii

The Holy Hand Grenade

1949 Chevy Duplo

Woodmore

1949 Chevy Duplo

Apple Watch Dock

Jude

Apple Watch Dock

YoYo JoJo

gillis