openbcimz4250hollow boxglowforge plusmare nostrum board gamestealth lockjim darkmagicschlotdab matbulldog frenchalcatel pop 4 plusknife bevelreverse blade katanafalchion swordtitanfall 2 sere kitski goggles5040 propellerbosch trimmernerf gun sightxv88 broadside battlesuitssilicone mold dildocatachan jungle fightersmhsvinyl record wall displaytoilet doll house
A beta sheet from a sucrose specific porin as cartoon
Free     Printables     Marius Mihasan

A beta sheet from a sucrose specific porin as cartoon

A betasheet from 1A0Spdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 chain ...
—   Go to Printables  

similar models —

A beta sheet from a sucrose specific porin as cartoon alternatives
A betasheet from a sucrose specific porin as cartoon with the sidechains visible
Marius Mihasan
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
A betasheet from a sucrose specific porin as balls and sticks
Marius Mihasan
A beta-sheet from a sucrose specific porin as balls and sticks
A beta sheet from a sucrose specific porin as surface
Marius Mihasan
A beta sheet from a sucrose specific porin as surface
An alpha helix from Hemoglobin as cartoon
Marius Mihasan
An alpha helix from Hemoglobin as cartoon
A betasheet from a sucrose specific porin peptide backbone as balls and sticks
Marius Mihasan
A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks
Spirit Geolink bracket
NZ2000
Spirit Geolink bracket
The Holy Hand Grenade
popejpii
The Holy Hand Grenade
1949 Chevy Duplo
Woodmore
1949 Chevy Duplo
Apple Watch Dock
Jude
Apple Watch Dock
YoYo JoJo
gillis
YoYo (JoJo)
2025 — TROFP — Privacy Policy