sodastream broken button fix
a320 speedbrake
bucket handle
robot mask
taig mill
storm shield 40k dark angels
eye of thundera
ring mandrel
drip nozzle
axe prop
c8 sfw
hitch
lamy safari
peugeot 104
sailor moon logo
imperial arrestor cruiser
1 8 tsp
sigelei fuchai 200w
gateway arch
captain picard chair
cable boot cover
toilet paper roll
awesom o
tank flames of war
true d
Free
Printables
Marius Mihasan
A beta sheet from a sucrose specific porin as cartoon
A betasheet from 1A0Spdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 chain ...
— Go to Printables
similar models —
A beta sheet from a sucrose specific porin as cartoon alternatives
Marius Mihasan
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
Marius Mihasan
A beta-sheet from a sucrose specific porin as balls and sticks
Marius Mihasan
A beta sheet from a sucrose specific porin as surface
Marius Mihasan
An alpha helix from Hemoglobin as cartoon
Marius Mihasan
A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks
NZ2000
Spirit Geolink bracket
popejpii
The Holy Hand Grenade
Woodmore
1949 Chevy Duplo
Jude
Apple Watch Dock
gillis
YoYo (JoJo)
Find more