cheese mold
polymer80 pf45
eachine e010s pro
berry picking 3d printed
bread lame
gallente
sewing machine spool holder
elite force
kensei muguruma
los angeles dodgers
female warlock
paw rugg
onyx rcr
zero two headband
skull toilet paper holder
rotating display stand
photon saber
schwinn ranger 2.6 fs
nms
cable guy controller holder
grand inquisitor
tesla emblem
witcher cat school
captain barnacles
cookie cutter stamp
Free
Printables
Marius Mihasan
A beta sheet from a sucrose specific porin as cartoon
A betasheet from 1A0Spdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 chain ...
— Go to Printables
similar models —
A beta sheet from a sucrose specific porin as cartoon alternatives
Marius Mihasan
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
Marius Mihasan
A beta-sheet from a sucrose specific porin as balls and sticks
Marius Mihasan
A beta sheet from a sucrose specific porin as surface
Marius Mihasan
An alpha helix from Hemoglobin as cartoon
Marius Mihasan
A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks
NZ2000
Spirit Geolink bracket
popejpii
The Holy Hand Grenade
Woodmore
1949 Chevy Duplo
Jude
Apple Watch Dock
gillis
YoYo (JoJo)
Find more
