color wheel
pn532 elechouse
plumette
5015 radial fan
cat bus
jay and silent bob
shave brush
bug box
stm32 nucleo
earring back
caliper holder
dark wizard
mikado vbar
ads b
timing pulley
robocat 270 fpv
baneblade
risk of rain 2 mercenary
atlas 618
esp 01 programmer
surfing girl
gundam stargazer
battletech elemental
formlabs
mini 4wd track
Free
Printables
Marius Mihasan
A beta sheet from a sucrose specific porin as surface
A betasheet from 1A0Spdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 chain ...
— Go to Printables
similar models —
A beta sheet from a sucrose specific porin as surface alternatives
Marius Mihasan
A beta-sheet from a sucrose specific porin as balls and sticks
Marius Mihasan
A beta sheet from a sucrose specific porin as cartoon
Marius Mihasan
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
Marius Mihasan
An alpha helix from Hemoglobin as surface
Marius Mihasan
B-DNA dodecamer as surface
Marius Mihasan
B-DNA dodecamer as surface
Marius Mihasan
A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks
NZ2000
Spirit Geolink bracket
popejpii
The Holy Hand Grenade
Woodmore
1949 Chevy Duplo
Find more