good idea
kaypro ii
dart zone pro mk2
kme knife sharpener
peep hole
sonoff din rail
frsky rx4r receiver
hi capa marui
bq prusa i3 hephestos sensor
77mm filter
anki vector robot
venus statue
rc plane skywalker
stamping machine
beemo league
tennis string dampener
trophy truck
aeropress scoop
sadako
spinning wheel parts
keanu
serre cable
wood floor
submersible water pump
hulk incredable marvel disney superhero movie toy figure avengers endgame 3d sculpture
Free
Printables
Marius Mihasan
A beta sheet from a sucrose specific porin as surface
A betasheet from 1A0Spdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 chain ...
— Go to Printables
similar models —
A beta sheet from a sucrose specific porin as surface alternatives
Marius Mihasan
A beta-sheet from a sucrose specific porin as balls and sticks
Marius Mihasan
A beta sheet from a sucrose specific porin as cartoon
Marius Mihasan
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
Marius Mihasan
An alpha helix from Hemoglobin as surface
Marius Mihasan
B-DNA dodecamer as surface
Marius Mihasan
B-DNA dodecamer as surface
Marius Mihasan
A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks
NZ2000
Spirit Geolink bracket
popejpii
The Holy Hand Grenade
Woodmore
1949 Chevy Duplo
Find more