handpresso 35mm
rabbit 3d
texas tech
bmw f10
magazine loader 22lr
evangelion lilith
jeep hitch cover
killerwhale
siberian tiger
armenian rings
perception sound kayak
atlas recovery vehicle
taranis qx7 crossfire
sram chain gap tool
oryx the taken king
red hood helmet
pex tool
ironman 3
fan test
bracelet montre
beeverycreative
photo frame a4
evil mage
besalisk
operation game
Free
Printables
Marius Mihasan
A beta sheet from a sucrose specific porin as surface
A betasheet from 1A0Spdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 chain ...
— Go to Printables
similar models —
A beta sheet from a sucrose specific porin as surface alternatives
Marius Mihasan
A beta-sheet from a sucrose specific porin as balls and sticks
Marius Mihasan
A beta sheet from a sucrose specific porin as cartoon
Marius Mihasan
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
Marius Mihasan
An alpha helix from Hemoglobin as surface
Marius Mihasan
B-DNA dodecamer as surface
Marius Mihasan
B-DNA dodecamer as surface
Marius Mihasan
A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks
NZ2000
Spirit Geolink bracket
popejpii
The Holy Hand Grenade
Woodmore
1949 Chevy Duplo
Find more