lil peep keychain
toilet cistern lever arm
necklace stand
battlefleet gothic firestorm
moon boot
helical gear
world map with compass
overwatch ashe hat
nsu
starcraft ii
sarpbc
nerf firefly
zipper clip
helicopter fuselage
bullion
grass sword
thor shot hair
joule sous vide
alien king
bruni flame mode
takenoko panda
raspberry pi hard drive case
ellie tattoo
snapback
sin of wrath
Free
Printables
Marius Mihasan
A beta sheet from a sucrose specific porin as surface
A betasheet from 1A0Spdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 chain ...
— Go to Printables
similar models —
A beta sheet from a sucrose specific porin as surface alternatives
Marius Mihasan
A beta-sheet from a sucrose specific porin as balls and sticks
Marius Mihasan
A beta sheet from a sucrose specific porin as cartoon
Marius Mihasan
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
Marius Mihasan
An alpha helix from Hemoglobin as surface
Marius Mihasan
B-DNA dodecamer as surface
Marius Mihasan
B-DNA dodecamer as surface
Marius Mihasan
A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks
NZ2000
Spirit Geolink bracket
popejpii
The Holy Hand Grenade
Woodmore
1949 Chevy Duplo
Find more