dji f550honda vtxlihkglouis vuitton logomini toolboxthor chest armorcupcake keychainviper titanfall 2classic cybermanbicycle machinelens hood 58mmmaster airbrush g233umarex speed loadermatte black cybertrucktrolley jackftc linear slideclockwork golemcyma cm350gundam gouf custommaster airbrushrocket league scarabbeer beltdna 75bose controllerthree eyed
A betasheet from a sucrose specific porin as balls and sticks
Free     Printables     Marius Mihasan

A beta-sheet from a sucrose specific porin as balls and sticks

A betasheet from 1A0Spdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 chain ...
—   Go to Printables  

similar models —

A beta-sheet from a sucrose specific porin as balls and sticks alternatives
A beta sheet from a sucrose specific porin as surface
Marius Mihasan
A beta sheet from a sucrose specific porin as surface
A beta sheet from a sucrose specific porin as cartoon
Marius Mihasan
A beta sheet from a sucrose specific porin as cartoon
A betasheet from a sucrose specific porin as cartoon with the sidechains visible
Marius Mihasan
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
An alpha helix from Hemoglobin as balls and sticks
Marius Mihasan
An alpha helix from Hemoglobin as balls and sticks
The peptide backbone of an alpha helix from Hemoglobin as balls and sticks
Marius Mihasan
The peptide backbone of an alpha helix from Hemoglobin as balls and sticks
Ball and Socket Clamp
JaredP7612
Ball and Socket Clamp
Locking Ball and Socket Joint
degroof
Locking Ball and Socket Joint
Ball and Socket
Coder-Tronics
Ball and Socket
Ball and Socket Joint
Koyo
Ball and Socket Joint
Ball and Socket LED Lamp for 10mm x 50mm LED Strip Sections
bluebomber
Ball and Socket LED Lamp for 10mm x 50mm LED Strip Sections
2026 — TROFP — Privacy Policy