chromebox
marco de fotos
captain falcon
torre de hercules
board games marco polo
millenium rod
soap mold
periodic table chocolate mold
fritz repeater 3000
echo dot 3rd gen wall mount
ender 3 v2
ghostbusters proton pack toy
p92 gun
smiley face keychain
dantdm logo
dungeons and dragons eric
railroad crossing
young black dragon
overwatch brigitte
dummy battery
playmobil house stairs
walking stick handle
chronicles of riddick
travis scott
svalnas ikea
Free
Printables
Marius Mihasan
A beta-sheet from a sucrose specific porin as balls and sticks
A betasheet from 1A0Spdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 chain ...
— Go to Printables
similar models —
A beta-sheet from a sucrose specific porin as balls and sticks alternatives
Marius Mihasan
A beta sheet from a sucrose specific porin as surface
Marius Mihasan
A beta sheet from a sucrose specific porin as cartoon
Marius Mihasan
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
Marius Mihasan
An alpha helix from Hemoglobin as balls and sticks
Marius Mihasan
The peptide backbone of an alpha helix from Hemoglobin as balls and sticks
JaredP7612
Ball and Socket Clamp
degroof
Locking Ball and Socket Joint
Coder-Tronics
Ball and Socket
Koyo
Ball and Socket Joint
bluebomber
Ball and Socket LED Lamp for 10mm x 50mm LED Strip Sections
Find more