daz studio
sasuke susanoo
picard badge
iron man
bob ross
fully 3d printed
wooden case
bulls horn
mk23 lam
halo noble 6
formula 1 trophy
wheel magnet
lion o
tacoma 2nd gen
arctis pro wireless
phone holster
xb6 modem
car transporter
rmr mount
designer toy
tarasque
six little nightmares
monster hunter rise
onewheel battery
bike chain
Free
Printables
Marius Mihasan
A beta-sheet from a sucrose specific porin as balls and sticks
A betasheet from 1A0Spdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 chain ...
— Go to Printables
similar models —
A beta-sheet from a sucrose specific porin as balls and sticks alternatives
Marius Mihasan
A beta sheet from a sucrose specific porin as surface
Marius Mihasan
A beta sheet from a sucrose specific porin as cartoon
Marius Mihasan
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
Marius Mihasan
An alpha helix from Hemoglobin as balls and sticks
Marius Mihasan
The peptide backbone of an alpha helix from Hemoglobin as balls and sticks
JaredP7612
Ball and Socket Clamp
degroof
Locking Ball and Socket Joint
Coder-Tronics
Ball and Socket
Koyo
Ball and Socket Joint
bluebomber
Ball and Socket LED Lamp for 10mm x 50mm LED Strip Sections
Find more